Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024688-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 28 homolog (S. cerevisiae)
Gene Name: VPS28
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059323: 96%, ENSRNOG00000014633: 96%
Entrez Gene ID: 51160
Uniprot ID: Q9UK41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACS
Gene Sequence MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACS
Gene ID - Mouse ENSMUSG00000059323
Gene ID - Rat ENSRNOG00000014633
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation)
Datasheet Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation)
Datasheet Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VPS28 pAb (ATL-HPA024688 w/enhanced validation)