Anti VPS25 pAb (ATL-HPA057284)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057284-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VPS25
Alternative Gene Name: DERP9, EAP20, MGC10540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078656: 98%, ENSRNOG00000051179: 96%
Entrez Gene ID: 84313
Uniprot ID: Q9BRG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSD |
| Gene Sequence | WLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSD |
| Gene ID - Mouse | ENSMUSG00000078656 |
| Gene ID - Rat | ENSRNOG00000051179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS25 pAb (ATL-HPA057284) | |
| Datasheet | Anti VPS25 pAb (ATL-HPA057284) Datasheet (External Link) |
| Vendor Page | Anti VPS25 pAb (ATL-HPA057284) at Atlas Antibodies |
| Documents & Links for Anti VPS25 pAb (ATL-HPA057284) | |
| Datasheet | Anti VPS25 pAb (ATL-HPA057284) Datasheet (External Link) |
| Vendor Page | Anti VPS25 pAb (ATL-HPA057284) |