Anti VPS25 pAb (ATL-HPA052217)

Atlas Antibodies

Catalog No.:
ATL-HPA052217-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 25 homolog (S. cerevisiae)
Gene Name: VPS25
Alternative Gene Name: DERP9, EAP20, MGC10540
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078656: 100%, ENSRNOG00000051179: 100%
Entrez Gene ID: 84313
Uniprot ID: Q9BRG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL
Gene Sequence AMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVL
Gene ID - Mouse ENSMUSG00000078656
Gene ID - Rat ENSRNOG00000051179
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS25 pAb (ATL-HPA052217)
Datasheet Anti VPS25 pAb (ATL-HPA052217) Datasheet (External Link)
Vendor Page Anti VPS25 pAb (ATL-HPA052217) at Atlas Antibodies

Documents & Links for Anti VPS25 pAb (ATL-HPA052217)
Datasheet Anti VPS25 pAb (ATL-HPA052217) Datasheet (External Link)
Vendor Page Anti VPS25 pAb (ATL-HPA052217)