Anti VPS16 pAb (ATL-HPA048661)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048661-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: VPS16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027411: 99%, ENSRNOG00000021222: 99%
Entrez Gene ID: 64601
Uniprot ID: Q9H269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ |
| Gene Sequence | LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQ |
| Gene ID - Mouse | ENSMUSG00000027411 |
| Gene ID - Rat | ENSRNOG00000021222 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VPS16 pAb (ATL-HPA048661) | |
| Datasheet | Anti VPS16 pAb (ATL-HPA048661) Datasheet (External Link) |
| Vendor Page | Anti VPS16 pAb (ATL-HPA048661) at Atlas Antibodies |
| Documents & Links for Anti VPS16 pAb (ATL-HPA048661) | |
| Datasheet | Anti VPS16 pAb (ATL-HPA048661) Datasheet (External Link) |
| Vendor Page | Anti VPS16 pAb (ATL-HPA048661) |