Anti VPS16 pAb (ATL-HPA043229)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043229-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VPS16
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027411: 97%, ENSRNOG00000021222: 97%
Entrez Gene ID: 64601
Uniprot ID: Q9H269
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLP |
Gene Sequence | AADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLP |
Gene ID - Mouse | ENSMUSG00000027411 |
Gene ID - Rat | ENSRNOG00000021222 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VPS16 pAb (ATL-HPA043229) | |
Datasheet | Anti VPS16 pAb (ATL-HPA043229) Datasheet (External Link) |
Vendor Page | Anti VPS16 pAb (ATL-HPA043229) at Atlas Antibodies |
Documents & Links for Anti VPS16 pAb (ATL-HPA043229) | |
Datasheet | Anti VPS16 pAb (ATL-HPA043229) Datasheet (External Link) |
Vendor Page | Anti VPS16 pAb (ATL-HPA043229) |