Anti VPS13D pAb (ATL-HPA051621)

Atlas Antibodies

Catalog No.:
ATL-HPA051621-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vacuolar protein sorting 13 homolog D (S. cerevisiae)
Gene Name: VPS13D
Alternative Gene Name: FLJ10619, KIAA0453
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020220: 100%, ENSRNOG00000016443: 99%
Entrez Gene ID: 55187
Uniprot ID: Q5THJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Gene Sequence WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Gene ID - Mouse ENSMUSG00000020220
Gene ID - Rat ENSRNOG00000016443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VPS13D pAb (ATL-HPA051621)
Datasheet Anti VPS13D pAb (ATL-HPA051621) Datasheet (External Link)
Vendor Page Anti VPS13D pAb (ATL-HPA051621) at Atlas Antibodies

Documents & Links for Anti VPS13D pAb (ATL-HPA051621)
Datasheet Anti VPS13D pAb (ATL-HPA051621) Datasheet (External Link)
Vendor Page Anti VPS13D pAb (ATL-HPA051621)