Anti VPS13B pAb (ATL-HPA043865)

Atlas Antibodies

Catalog No.: ATL-HPA043865-25

Protein Description: vacuolar protein sorting 13 homolog B (yeast)
Gene Name: VPS13B
Alternative Gene Name: CHS1, COH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037646: 83%, ENSRNOG00000057443: 27%
Entrez Gene ID: 157680
Uniprot ID: Q7Z7G8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
• Gene Sequence: PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
• Gene ID - Mouse: ENSMUSG00000037646
• Gene ID - Rat: ENSRNOG00000057443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VPS13B pAb (ATL-HPA043865) – 1 Found

Koike, Seiichi; Jahn, Reinhard. SNAREs define targeting specificity of trafficking vesicles by combinatorial interaction with tethering factors. Nature Communications. 2019;10(1):1608.