Anti VMA21 pAb (ATL-HPA010972)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010972-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VMA21
Alternative Gene Name: MEAX, XMEA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073131: 76%, ENSRNOG00000026150: 37%
Entrez Gene ID: 203547
Uniprot ID: Q3ZAQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR |
| Gene Sequence | PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR |
| Gene ID - Mouse | ENSMUSG00000073131 |
| Gene ID - Rat | ENSRNOG00000026150 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VMA21 pAb (ATL-HPA010972) | |
| Datasheet | Anti VMA21 pAb (ATL-HPA010972) Datasheet (External Link) |
| Vendor Page | Anti VMA21 pAb (ATL-HPA010972) at Atlas Antibodies |
| Documents & Links for Anti VMA21 pAb (ATL-HPA010972) | |
| Datasheet | Anti VMA21 pAb (ATL-HPA010972) Datasheet (External Link) |
| Vendor Page | Anti VMA21 pAb (ATL-HPA010972) |
| Citations for Anti VMA21 pAb (ATL-HPA010972) – 1 Found |
| Esmail, Sally; Kartner, Norbert; Yao, Yeqi; Kim, Joo Wan; Reithmeier, Reinhart A F; Manolson, Morris F. Molecular mechanisms of cutis laxa- and distal renal tubular acidosis-causing mutations in V-ATPase a subunits, ATP6V0A2 and ATP6V0A4. The Journal Of Biological Chemistry. 2018;293(8):2787-2800. PubMed |