Anti VMA21 pAb (ATL-HPA010972)

Atlas Antibodies

Catalog No.:
ATL-HPA010972-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)
Gene Name: VMA21
Alternative Gene Name: MEAX, XMEA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073131: 76%, ENSRNOG00000026150: 37%
Entrez Gene ID: 203547
Uniprot ID: Q3ZAQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR
Gene Sequence PRRTMLRGKSRLNVEWLGYSPGLLLEHRPLLAGRTPRSHRR
Gene ID - Mouse ENSMUSG00000073131
Gene ID - Rat ENSRNOG00000026150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VMA21 pAb (ATL-HPA010972)
Datasheet Anti VMA21 pAb (ATL-HPA010972) Datasheet (External Link)
Vendor Page Anti VMA21 pAb (ATL-HPA010972) at Atlas Antibodies

Documents & Links for Anti VMA21 pAb (ATL-HPA010972)
Datasheet Anti VMA21 pAb (ATL-HPA010972) Datasheet (External Link)
Vendor Page Anti VMA21 pAb (ATL-HPA010972)
Citations for Anti VMA21 pAb (ATL-HPA010972) – 1 Found
Esmail, Sally; Kartner, Norbert; Yao, Yeqi; Kim, Joo Wan; Reithmeier, Reinhart A F; Manolson, Morris F. Molecular mechanisms of cutis laxa- and distal renal tubular acidosis-causing mutations in V-ATPase a subunits, ATP6V0A2 and ATP6V0A4. The Journal Of Biological Chemistry. 2018;293(8):2787-2800.  PubMed