Anti VIPR2 pAb (ATL-HPA062707)

Atlas Antibodies

Catalog No.:
ATL-HPA062707-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: vasoactive intestinal peptide receptor 2
Gene Name: VIPR2
Alternative Gene Name: VPAC2, VPAC2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011171: 89%, ENSRNOG00000004317: 89%
Entrez Gene ID: 7434
Uniprot ID: P41587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR
Gene Sequence NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR
Gene ID - Mouse ENSMUSG00000011171
Gene ID - Rat ENSRNOG00000004317
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VIPR2 pAb (ATL-HPA062707)
Datasheet Anti VIPR2 pAb (ATL-HPA062707) Datasheet (External Link)
Vendor Page Anti VIPR2 pAb (ATL-HPA062707) at Atlas Antibodies

Documents & Links for Anti VIPR2 pAb (ATL-HPA062707)
Datasheet Anti VIPR2 pAb (ATL-HPA062707) Datasheet (External Link)
Vendor Page Anti VIPR2 pAb (ATL-HPA062707)