Anti VIPR2 pAb (ATL-HPA062707)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062707-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VIPR2
Alternative Gene Name: VPAC2, VPAC2R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011171: 89%, ENSRNOG00000004317: 89%
Entrez Gene ID: 7434
Uniprot ID: P41587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR |
Gene Sequence | NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR |
Gene ID - Mouse | ENSMUSG00000011171 |
Gene ID - Rat | ENSRNOG00000004317 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VIPR2 pAb (ATL-HPA062707) | |
Datasheet | Anti VIPR2 pAb (ATL-HPA062707) Datasheet (External Link) |
Vendor Page | Anti VIPR2 pAb (ATL-HPA062707) at Atlas Antibodies |
Documents & Links for Anti VIPR2 pAb (ATL-HPA062707) | |
Datasheet | Anti VIPR2 pAb (ATL-HPA062707) Datasheet (External Link) |
Vendor Page | Anti VIPR2 pAb (ATL-HPA062707) |