Anti VGLL4 pAb (ATL-HPA038614 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038614-25

Protein Description: vestigial-like family member 4
Gene Name: VGLL4
Alternative Gene Name: KIAA0121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030315: 97%, ENSRNOG00000007822: 97%
Entrez Gene ID: 9686
Uniprot ID: Q14135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS
• Gene Sequence: EEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHS
• Gene ID - Mouse: ENSMUSG00000030315
• Gene ID - Rat: ENSRNOG00000007822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.