Anti VGLL4 pAb (ATL-HPA038225)

Atlas Antibodies

Catalog No.: ATL-HPA038225-100

Protein Description: vestigial-like family member 4
Gene Name: VGLL4
Alternative Gene Name: KIAA0121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030315: 88%, ENSRNOG00000007822: 86%
Entrez Gene ID: 9686
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
• Gene Sequence: PISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLP
• Gene ID - Mouse: ENSMUSG00000030315
• Gene ID - Rat: ENSRNOG00000007822
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VGLL4 pAb (ATL-HPA038225) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.