Anti VGLL3 pAb (ATL-HPA054983)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054983-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: VGLL3
Alternative Gene Name: VGL-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091243: 89%, ENSRNOG00000028774: 90%
Entrez Gene ID: 389136
Uniprot ID: A8MV65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE |
Gene Sequence | CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE |
Gene ID - Mouse | ENSMUSG00000091243 |
Gene ID - Rat | ENSRNOG00000028774 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VGLL3 pAb (ATL-HPA054983) | |
Datasheet | Anti VGLL3 pAb (ATL-HPA054983) Datasheet (External Link) |
Vendor Page | Anti VGLL3 pAb (ATL-HPA054983) at Atlas Antibodies |
Documents & Links for Anti VGLL3 pAb (ATL-HPA054983) | |
Datasheet | Anti VGLL3 pAb (ATL-HPA054983) Datasheet (External Link) |
Vendor Page | Anti VGLL3 pAb (ATL-HPA054983) |
Citations for Anti VGLL3 pAb (ATL-HPA054983) – 1 Found |
Du, Yu; Cui, Ran; Tian, Na; Chen, Miao; Zhang, Xian-Long; Dai, Sheng-Ming. Regulation of type I interferon signature by VGLL3 in the fibroblast-like synoviocytes of rheumatoid arthritis patients via targeting the Hippo pathway. Arthritis Research & Therapy. 2022;24(1):188. PubMed |