Anti VGLL3 pAb (ATL-HPA054983)

Atlas Antibodies

Catalog No.:
ATL-HPA054983-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: vestigial-like family member 3
Gene Name: VGLL3
Alternative Gene Name: VGL-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091243: 89%, ENSRNOG00000028774: 90%
Entrez Gene ID: 389136
Uniprot ID: A8MV65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE
Gene Sequence CAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQE
Gene ID - Mouse ENSMUSG00000091243
Gene ID - Rat ENSRNOG00000028774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VGLL3 pAb (ATL-HPA054983)
Datasheet Anti VGLL3 pAb (ATL-HPA054983) Datasheet (External Link)
Vendor Page Anti VGLL3 pAb (ATL-HPA054983) at Atlas Antibodies

Documents & Links for Anti VGLL3 pAb (ATL-HPA054983)
Datasheet Anti VGLL3 pAb (ATL-HPA054983) Datasheet (External Link)
Vendor Page Anti VGLL3 pAb (ATL-HPA054983)
Citations for Anti VGLL3 pAb (ATL-HPA054983) – 1 Found
Du, Yu; Cui, Ran; Tian, Na; Chen, Miao; Zhang, Xian-Long; Dai, Sheng-Ming. Regulation of type I interferon signature by VGLL3 in the fibroblast-like synoviocytes of rheumatoid arthritis patients via targeting the Hippo pathway. Arthritis Research & Therapy. 2022;24(1):188.  PubMed