Anti VGLL1 pAb (ATL-HPA064616)

Atlas Antibodies

Catalog No.:
ATL-HPA064616-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: vestigial-like family member 1
Gene Name: VGLL1
Alternative Gene Name: TDU, TONDU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031131: 44%, ENSRNOG00000059006: 33%
Entrez Gene ID: 51442
Uniprot ID: Q99990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
Gene Sequence LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
Gene ID - Mouse ENSMUSG00000031131
Gene ID - Rat ENSRNOG00000059006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VGLL1 pAb (ATL-HPA064616)
Datasheet Anti VGLL1 pAb (ATL-HPA064616) Datasheet (External Link)
Vendor Page Anti VGLL1 pAb (ATL-HPA064616) at Atlas Antibodies

Documents & Links for Anti VGLL1 pAb (ATL-HPA064616)
Datasheet Anti VGLL1 pAb (ATL-HPA064616) Datasheet (External Link)
Vendor Page Anti VGLL1 pAb (ATL-HPA064616)
Citations for Anti VGLL1 pAb (ATL-HPA064616) – 1 Found
Mori, Seiichiro; Takeuchi, Takamasa; Ishii, Yoshiyuki; Kukimoto, Iwao. The Transcriptional Cofactor VGLL1 Drives Transcription of Human Papillomavirus Early Genes via TEAD1. Journal Of Virology. 2020;94(10)  PubMed