Anti VGLL1 pAb (ATL-HPA064616)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064616-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: VGLL1
Alternative Gene Name: TDU, TONDU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031131: 44%, ENSRNOG00000059006: 33%
Entrez Gene ID: 51442
Uniprot ID: Q99990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH |
| Gene Sequence | LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH |
| Gene ID - Mouse | ENSMUSG00000031131 |
| Gene ID - Rat | ENSRNOG00000059006 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VGLL1 pAb (ATL-HPA064616) | |
| Datasheet | Anti VGLL1 pAb (ATL-HPA064616) Datasheet (External Link) |
| Vendor Page | Anti VGLL1 pAb (ATL-HPA064616) at Atlas Antibodies |
| Documents & Links for Anti VGLL1 pAb (ATL-HPA064616) | |
| Datasheet | Anti VGLL1 pAb (ATL-HPA064616) Datasheet (External Link) |
| Vendor Page | Anti VGLL1 pAb (ATL-HPA064616) |
| Citations for Anti VGLL1 pAb (ATL-HPA064616) – 1 Found |
| Mori, Seiichiro; Takeuchi, Takamasa; Ishii, Yoshiyuki; Kukimoto, Iwao. The Transcriptional Cofactor VGLL1 Drives Transcription of Human Papillomavirus Early Genes via TEAD1. Journal Of Virology. 2020;94(10) PubMed |