Anti VGLL1 pAb (ATL-HPA064616)

Atlas Antibodies

Catalog No.: ATL-HPA064616-25

Protein Description: vestigial-like family member 1
Gene Name: VGLL1
Alternative Gene Name: TDU, TONDU
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031131: 44%, ENSRNOG00000059006: 33%
Entrez Gene ID: 51442
Uniprot ID: Q99990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
• Gene Sequence: LSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGH
• Gene ID - Mouse: ENSMUSG00000031131
• Gene ID - Rat: ENSRNOG00000059006
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VGLL1 pAb (ATL-HPA064616) – 1 Found

Mori, Seiichiro; Takeuchi, Takamasa; Ishii, Yoshiyuki; Kukimoto, Iwao. The Transcriptional Cofactor VGLL1 Drives Transcription of Human Papillomavirus Early Genes via TEAD1. Journal Of Virology. 2020;94(10)