Anti VGF pAb (ATL-HPA055177 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055177-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: VGF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037428: 90%, ENSRNOG00000001416: 89%
Entrez Gene ID: 7425
Uniprot ID: O15240
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV |
Gene Sequence | APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV |
Gene ID - Mouse | ENSMUSG00000037428 |
Gene ID - Rat | ENSRNOG00000001416 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VGF pAb (ATL-HPA055177 w/enhanced validation) | |
Datasheet | Anti VGF pAb (ATL-HPA055177 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VGF pAb (ATL-HPA055177 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti VGF pAb (ATL-HPA055177 w/enhanced validation) | |
Datasheet | Anti VGF pAb (ATL-HPA055177 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VGF pAb (ATL-HPA055177 w/enhanced validation) |
Citations for Anti VGF pAb (ATL-HPA055177 w/enhanced validation) – 1 Found |
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |