Anti VENTX pAb (ATL-HPA050955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050955-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VENTX
Alternative Gene Name: HPX42B, VENTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048528: 40%, ENSRNOG00000017006: 40%
Entrez Gene ID: 27287
Uniprot ID: O95231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL |
Gene Sequence | GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL |
Gene ID - Mouse | ENSMUSG00000048528 |
Gene ID - Rat | ENSRNOG00000017006 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VENTX pAb (ATL-HPA050955) | |
Datasheet | Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link) |
Vendor Page | Anti VENTX pAb (ATL-HPA050955) at Atlas Antibodies |
Documents & Links for Anti VENTX pAb (ATL-HPA050955) | |
Datasheet | Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link) |
Vendor Page | Anti VENTX pAb (ATL-HPA050955) |