Anti VENTX pAb (ATL-HPA050955)

Atlas Antibodies

Catalog No.:
ATL-HPA050955-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: VENT homeobox
Gene Name: VENTX
Alternative Gene Name: HPX42B, VENTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048528: 40%, ENSRNOG00000017006: 40%
Entrez Gene ID: 27287
Uniprot ID: O95231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL
Gene Sequence GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL
Gene ID - Mouse ENSMUSG00000048528
Gene ID - Rat ENSRNOG00000017006
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VENTX pAb (ATL-HPA050955)
Datasheet Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link)
Vendor Page Anti VENTX pAb (ATL-HPA050955) at Atlas Antibodies

Documents & Links for Anti VENTX pAb (ATL-HPA050955)
Datasheet Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link)
Vendor Page Anti VENTX pAb (ATL-HPA050955)