Anti VENTX pAb (ATL-HPA050955)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050955-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VENTX
Alternative Gene Name: HPX42B, VENTX2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048528: 40%, ENSRNOG00000017006: 40%
Entrez Gene ID: 27287
Uniprot ID: O95231
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL |
| Gene Sequence | GSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPL |
| Gene ID - Mouse | ENSMUSG00000048528 |
| Gene ID - Rat | ENSRNOG00000017006 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VENTX pAb (ATL-HPA050955) | |
| Datasheet | Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link) |
| Vendor Page | Anti VENTX pAb (ATL-HPA050955) at Atlas Antibodies |
| Documents & Links for Anti VENTX pAb (ATL-HPA050955) | |
| Datasheet | Anti VENTX pAb (ATL-HPA050955) Datasheet (External Link) |
| Vendor Page | Anti VENTX pAb (ATL-HPA050955) |