Anti VEGFD pAb (ATL-HPA027342 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027342-25

Protein Description: vascular endothelial growth factor D
Gene Name: VEGFD
Alternative Gene Name: FIGF, VEGF-D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031380: 86%, ENSRNOG00000003587: 89%
Entrez Gene ID: 2277
Uniprot ID: O43915
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT
• Gene Sequence: TGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEENPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETCCQKHKLFHPDT
• Gene ID - Mouse: ENSMUSG00000031380
• Gene ID - Rat: ENSRNOG00000003587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VEGFD pAb (ATL-HPA027342 w/enhanced validation) – 2 Found

Zhang, Jincheng; Wei, Bin; Hu, Huixian; Liu, Fanrong; Tu, Yan; Zhao, Minzhe; Wu, Dongmei. Preliminary study on decreasing the expression of FOXP3 with miR-155 to inhibit diffuse large B-cell lymphoma. Oncology Letters. 2017;14(2):1711-1718. 

An, Qi; Han, Chao; Zhou, Yubing; Li, Feng; Li, Duolu; Zhang, Xiaojian; Yu, Zujiang; Duan, Zhenfeng; Kan, Quancheng. Matrine induces cell cycle arrest and apoptosis with recovery of the expression of miR-126 in the A549 non-small cell lung cancer cell line. Molecular Medicine Reports. 2016;14(5):4042-4048.