Anti VEGFA pAb (ATL-HPA069116)

Atlas Antibodies

Catalog No.:
ATL-HPA069116-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: vascular endothelial growth factor A
Gene Name: VEGFA
Alternative Gene Name: VEGF, VEGF-A, VPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023951: 86%, ENSRNOG00000019598: 88%
Entrez Gene ID: 7422
Uniprot ID: P15692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP
Gene Sequence KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP
Gene ID - Mouse ENSMUSG00000023951
Gene ID - Rat ENSRNOG00000019598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VEGFA pAb (ATL-HPA069116)
Datasheet Anti VEGFA pAb (ATL-HPA069116) Datasheet (External Link)
Vendor Page Anti VEGFA pAb (ATL-HPA069116) at Atlas Antibodies

Documents & Links for Anti VEGFA pAb (ATL-HPA069116)
Datasheet Anti VEGFA pAb (ATL-HPA069116) Datasheet (External Link)
Vendor Page Anti VEGFA pAb (ATL-HPA069116)
Citations for Anti VEGFA pAb (ATL-HPA069116) – 1 Found
Yu, Tao; You, Xiaomeng; Zhou, Haichao; He, Wenbao; Li, Zihua; Li, Bing; Xia, Jiang; Zhu, Hui; Zhao, Youguang; Yu, Guangrong; Xiong, Yuan; Yang, Yunfeng. MiR-16-5p regulates postmenopausal osteoporosis by directly targeting VEGFA. Aging. 2020;12(10):9500-9514.  PubMed