Anti VEGFA pAb (ATL-HPA069116)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069116-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: VEGFA
Alternative Gene Name: VEGF, VEGF-A, VPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023951: 86%, ENSRNOG00000019598: 88%
Entrez Gene ID: 7422
Uniprot ID: P15692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP |
| Gene Sequence | KWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP |
| Gene ID - Mouse | ENSMUSG00000023951 |
| Gene ID - Rat | ENSRNOG00000019598 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VEGFA pAb (ATL-HPA069116) | |
| Datasheet | Anti VEGFA pAb (ATL-HPA069116) Datasheet (External Link) |
| Vendor Page | Anti VEGFA pAb (ATL-HPA069116) at Atlas Antibodies |
| Documents & Links for Anti VEGFA pAb (ATL-HPA069116) | |
| Datasheet | Anti VEGFA pAb (ATL-HPA069116) Datasheet (External Link) |
| Vendor Page | Anti VEGFA pAb (ATL-HPA069116) |
| Citations for Anti VEGFA pAb (ATL-HPA069116) – 1 Found |
| Yu, Tao; You, Xiaomeng; Zhou, Haichao; He, Wenbao; Li, Zihua; Li, Bing; Xia, Jiang; Zhu, Hui; Zhao, Youguang; Yu, Guangrong; Xiong, Yuan; Yang, Yunfeng. MiR-16-5p regulates postmenopausal osteoporosis by directly targeting VEGFA. Aging. 2020;12(10):9500-9514. PubMed |