Anti VDR pAb (ATL-HPA072102)

Atlas Antibodies

Catalog No.:
ATL-HPA072102-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: vitamin D receptor
Gene Name: VDR
Alternative Gene Name: NR1I1, PPP1R163
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022479: 86%, ENSRNOG00000054420: 89%
Entrez Gene ID: 7421
Uniprot ID: P11473
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN
Gene Sequence PGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLN
Gene ID - Mouse ENSMUSG00000022479
Gene ID - Rat ENSRNOG00000054420
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VDR pAb (ATL-HPA072102)
Datasheet Anti VDR pAb (ATL-HPA072102) Datasheet (External Link)
Vendor Page Anti VDR pAb (ATL-HPA072102) at Atlas Antibodies

Documents & Links for Anti VDR pAb (ATL-HPA072102)
Datasheet Anti VDR pAb (ATL-HPA072102) Datasheet (External Link)
Vendor Page Anti VDR pAb (ATL-HPA072102)