Anti VCPKMT pAb (ATL-HPA076561)

Atlas Antibodies

Catalog No.:
ATL-HPA076561-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: valosin containing protein lysine methyltransferase
Gene Name: VCPKMT
Alternative Gene Name: C14orf138, METTL21D, VCP-KMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049882: 85%, ENSRNOG00000021433: 27%
Entrez Gene ID: 79609
Uniprot ID: Q9H867
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKK
Gene Sequence EIEGFPSPPDFILMADCIYYEESLEPLLKTLKDISGFETCIICCYEQRTMGKNPEIEKKYFELLQLDFDFEKIPLEKHDEEYRSEDIHIIYIRKK
Gene ID - Mouse ENSMUSG00000049882
Gene ID - Rat ENSRNOG00000021433
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VCPKMT pAb (ATL-HPA076561)
Datasheet Anti VCPKMT pAb (ATL-HPA076561) Datasheet (External Link)
Vendor Page Anti VCPKMT pAb (ATL-HPA076561) at Atlas Antibodies

Documents & Links for Anti VCPKMT pAb (ATL-HPA076561)
Datasheet Anti VCPKMT pAb (ATL-HPA076561) Datasheet (External Link)
Vendor Page Anti VCPKMT pAb (ATL-HPA076561)