Anti VCL pAb (ATL-HPA063777 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063777-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: VCL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021823: 98%, ENSRNOG00000010765: 98%
Entrez Gene ID: 7414
Uniprot ID: P18206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP |
Gene Sequence | SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP |
Gene ID - Mouse | ENSMUSG00000021823 |
Gene ID - Rat | ENSRNOG00000010765 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) | |
Datasheet | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) | |
Datasheet | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti VCL pAb (ATL-HPA063777 w/enhanced validation) |
Citations for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) – 2 Found |
Rogg, Manuel; Maier, Jasmin I; Ehle, Markus; Sammarco, Alena; Schilling, Oliver; Werner, Martin; Schell, Christoph. NUP133 Controls Nuclear Pore Assembly, Transcriptome Composition, and Cytoskeleton Regulation in Podocytes. Cells. 2022;11(8) PubMed |
Kutle, Ivana; Szymańska-de Wijs, Katarzyna M; Bogdanow, Boris; Cuvalo, Berislav; Steinbrück, Lars; Jonjić, Stipan; Wagner, Karen; Niedenthal, Rainer; Selbach, Matthias; Wiebusch, Lüder; Dezeljin, Martina; Messerle, Martin. Murine Cytomegalovirus M25 Proteins Sequester the Tumor Suppressor Protein p53 in Nuclear Accumulations. Journal Of Virology. 2020;94(20) PubMed |