Anti VCL pAb (ATL-HPA063777 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA063777-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: vinculin
Gene Name: VCL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021823: 98%, ENSRNOG00000010765: 98%
Entrez Gene ID: 7414
Uniprot ID: P18206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP
Gene Sequence SALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGP
Gene ID - Mouse ENSMUSG00000021823
Gene ID - Rat ENSRNOG00000010765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation)
Datasheet Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VCL pAb (ATL-HPA063777 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VCL pAb (ATL-HPA063777 w/enhanced validation)
Datasheet Anti VCL pAb (ATL-HPA063777 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VCL pAb (ATL-HPA063777 w/enhanced validation)
Citations for Anti VCL pAb (ATL-HPA063777 w/enhanced validation) – 2 Found
Rogg, Manuel; Maier, Jasmin I; Ehle, Markus; Sammarco, Alena; Schilling, Oliver; Werner, Martin; Schell, Christoph. NUP133 Controls Nuclear Pore Assembly, Transcriptome Composition, and Cytoskeleton Regulation in Podocytes. Cells. 2022;11(8)  PubMed
Kutle, Ivana; Szymańska-de Wijs, Katarzyna M; Bogdanow, Boris; Cuvalo, Berislav; Steinbrück, Lars; Jonjić, Stipan; Wagner, Karen; Niedenthal, Rainer; Selbach, Matthias; Wiebusch, Lüder; Dezeljin, Martina; Messerle, Martin. Murine Cytomegalovirus M25 Proteins Sequester the Tumor Suppressor Protein p53 in Nuclear Accumulations. Journal Of Virology. 2020;94(20)  PubMed