Anti VCAM1 pAb (ATL-HPA069867)

Atlas Antibodies

SKU: ATL-HPA069867-25

• 
• 

Protein Description: vascular cell adhesion molecule 1
Gene Name: VCAM1
Alternative Gene Name: CD106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027962: 70%, ENSRNOG00000014333: 68%
Entrez Gene ID: 7412
Uniprot ID: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT
• Gene Sequence: ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT
• Gene ID - Mouse: ENSMUSG00000027962
• Gene ID - Rat: ENSRNOG00000014333
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.