Anti VCAM1 pAb (ATL-HPA069867)

Atlas Antibodies

Catalog No.:
ATL-HPA069867-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: vascular cell adhesion molecule 1
Gene Name: VCAM1
Alternative Gene Name: CD106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027962: 70%, ENSRNOG00000014333: 68%
Entrez Gene ID: 7412
Uniprot ID: P19320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT
Gene Sequence ITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPT
Gene ID - Mouse ENSMUSG00000027962
Gene ID - Rat ENSRNOG00000014333
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VCAM1 pAb (ATL-HPA069867)
Datasheet Anti VCAM1 pAb (ATL-HPA069867) Datasheet (External Link)
Vendor Page Anti VCAM1 pAb (ATL-HPA069867) at Atlas Antibodies

Documents & Links for Anti VCAM1 pAb (ATL-HPA069867)
Datasheet Anti VCAM1 pAb (ATL-HPA069867) Datasheet (External Link)
Vendor Page Anti VCAM1 pAb (ATL-HPA069867)