Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001864-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: VAV1
Alternative Gene Name: VAV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034116: 86%, ENSRNOG00000050430: 88%
Entrez Gene ID: 7409
Uniprot ID: P15498
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL |
| Gene Sequence | LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL |
| Gene ID - Mouse | ENSMUSG00000034116 |
| Gene ID - Rat | ENSRNOG00000050430 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) | |
| Datasheet | Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) | |
| Datasheet | Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) |
| Citations for Anti VAV1 pAb (ATL-HPA001864 w/enhanced validation) – 2 Found |
| Feddersen, Charlotte R; Schillo, Jacob L; Varzavand, Afshin; Vaughn, Hayley R; Wadsworth, Lexy S; Voigt, Andrew P; Zhu, Eliot Y; Jennings, Brooke M; Mullen, Sarah A; Bobera, Jeremy; Riordan, Jesse D; Stipp, Christopher S; Dupuy, Adam J. Src-Dependent DBL Family Members Drive Resistance to Vemurafenib in Human Melanoma. Cancer Research. 2019;79(19):5074-5087. PubMed |
| Shen, Yanting; Xu, Huan; Long, Manmei; Guo, Miaomiao; Li, Peizhang; Zhan, Ming; Wang, Zhong. Screening to Identify an Immune Landscape-Based Prognostic Predictor and Therapeutic Target for Prostate Cancer. Frontiers In Oncology. 11( 34804963):761643. PubMed |