Anti VAT1 pAb (ATL-HPA045170)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045170-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: VAT1
Alternative Gene Name: FLJ20230, VATI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034993: 95%, ENSRNOG00000020684: 95%
Entrez Gene ID: 10493
Uniprot ID: Q99536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH |
Gene Sequence | GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH |
Gene ID - Mouse | ENSMUSG00000034993 |
Gene ID - Rat | ENSRNOG00000020684 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti VAT1 pAb (ATL-HPA045170) | |
Datasheet | Anti VAT1 pAb (ATL-HPA045170) Datasheet (External Link) |
Vendor Page | Anti VAT1 pAb (ATL-HPA045170) at Atlas Antibodies |
Documents & Links for Anti VAT1 pAb (ATL-HPA045170) | |
Datasheet | Anti VAT1 pAb (ATL-HPA045170) Datasheet (External Link) |
Vendor Page | Anti VAT1 pAb (ATL-HPA045170) |