Anti VAT1 pAb (ATL-HPA045170)

Atlas Antibodies

Catalog No.:
ATL-HPA045170-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: vesicle amine transport 1
Gene Name: VAT1
Alternative Gene Name: FLJ20230, VATI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034993: 95%, ENSRNOG00000020684: 95%
Entrez Gene ID: 10493
Uniprot ID: Q99536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH
Gene Sequence GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH
Gene ID - Mouse ENSMUSG00000034993
Gene ID - Rat ENSRNOG00000020684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VAT1 pAb (ATL-HPA045170)
Datasheet Anti VAT1 pAb (ATL-HPA045170) Datasheet (External Link)
Vendor Page Anti VAT1 pAb (ATL-HPA045170) at Atlas Antibodies

Documents & Links for Anti VAT1 pAb (ATL-HPA045170)
Datasheet Anti VAT1 pAb (ATL-HPA045170) Datasheet (External Link)
Vendor Page Anti VAT1 pAb (ATL-HPA045170)