Anti VASN pAb (ATL-HPA016992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016992-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: VASN
Alternative Gene Name: SLITL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039646: 86%, ENSRNOG00000004141: 90%
Entrez Gene ID: 114990
Uniprot ID: Q6EMK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPTTRPVVREPTALSSSLAPT |
| Gene Sequence | LDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPTTRPVVREPTALSSSLAPT |
| Gene ID - Mouse | ENSMUSG00000039646 |
| Gene ID - Rat | ENSRNOG00000004141 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VASN pAb (ATL-HPA016992) | |
| Datasheet | Anti VASN pAb (ATL-HPA016992) Datasheet (External Link) |
| Vendor Page | Anti VASN pAb (ATL-HPA016992) at Atlas Antibodies |
| Documents & Links for Anti VASN pAb (ATL-HPA016992) | |
| Datasheet | Anti VASN pAb (ATL-HPA016992) Datasheet (External Link) |
| Vendor Page | Anti VASN pAb (ATL-HPA016992) |