Anti VARS2 pAb (ATL-HPA070267)

Atlas Antibodies

Catalog No.:
ATL-HPA070267-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: valyl-tRNA synthetase 2, mitochondrial
Gene Name: VARS2
Alternative Gene Name: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 85%, ENSRNOG00000000833: 85%
Entrez Gene ID: 57176
Uniprot ID: Q5ST30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Gene Sequence NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Gene ID - Mouse ENSMUSG00000038838
Gene ID - Rat ENSRNOG00000000833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VARS2 pAb (ATL-HPA070267)
Datasheet Anti VARS2 pAb (ATL-HPA070267) Datasheet (External Link)
Vendor Page Anti VARS2 pAb (ATL-HPA070267) at Atlas Antibodies

Documents & Links for Anti VARS2 pAb (ATL-HPA070267)
Datasheet Anti VARS2 pAb (ATL-HPA070267) Datasheet (External Link)
Vendor Page Anti VARS2 pAb (ATL-HPA070267)