Anti VARS2 pAb (ATL-HPA070267)

Atlas Antibodies

Catalog No.: ATL-HPA070267-25

Protein Description: valyl-tRNA synthetase 2, mitochondrial
Gene Name: VARS2
Alternative Gene Name: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 85%, ENSRNOG00000000833: 85%
Entrez Gene ID: 57176
Uniprot ID: Q5ST30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
• Gene Sequence: NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
• Gene ID - Mouse: ENSMUSG00000038838
• Gene ID - Rat: ENSRNOG00000000833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.