Anti VARS2 pAb (ATL-HPA062449)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062449-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VARS2
Alternative Gene Name: DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 85%, ENSRNOG00000000833: 85%
Entrez Gene ID: 57176
Uniprot ID: Q5ST30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE |
| Gene Sequence | NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE |
| Gene ID - Mouse | ENSMUSG00000038838 |
| Gene ID - Rat | ENSRNOG00000000833 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VARS2 pAb (ATL-HPA062449) | |
| Datasheet | Anti VARS2 pAb (ATL-HPA062449) Datasheet (External Link) |
| Vendor Page | Anti VARS2 pAb (ATL-HPA062449) at Atlas Antibodies |
| Documents & Links for Anti VARS2 pAb (ATL-HPA062449) | |
| Datasheet | Anti VARS2 pAb (ATL-HPA062449) Datasheet (External Link) |
| Vendor Page | Anti VARS2 pAb (ATL-HPA062449) |