Anti VARS pAb (ATL-HPA046710 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046710-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: valyl-tRNA synthetase
Gene Name: VARS
Alternative Gene Name: VARS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007029: 93%, ENSRNOG00000000867: 93%
Entrez Gene ID: 7407
Uniprot ID: P26640
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML
Gene Sequence AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML
Gene ID - Mouse ENSMUSG00000007029
Gene ID - Rat ENSRNOG00000000867
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti VARS pAb (ATL-HPA046710 w/enhanced validation)
Datasheet Anti VARS pAb (ATL-HPA046710 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VARS pAb (ATL-HPA046710 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti VARS pAb (ATL-HPA046710 w/enhanced validation)
Datasheet Anti VARS pAb (ATL-HPA046710 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti VARS pAb (ATL-HPA046710 w/enhanced validation)
Citations for Anti VARS pAb (ATL-HPA046710 w/enhanced validation) – 1 Found
Siekierska, Aleksandra; Stamberger, Hannah; Deconinck, Tine; Oprescu, Stephanie N; Partoens, Michèle; Zhang, Yifan; Sourbron, Jo; Adriaenssens, Elias; Mullen, Patrick; Wiencek, Patrick; Hardies, Katia; Lee, Jeong-Soo; Giong, Hoi-Khoanh; Distelmaier, Felix; Elpeleg, Orly; Helbig, Katherine L; Hersh, Joseph; Isikay, Sedat; Jordan, Elizabeth; Karaca, Ender; Kecskes, Angela; Lupski, James R; Kovacs-Nagy, Reka; May, Patrick; Narayanan, Vinodh; Pendziwiat, Manuela; Ramsey, Keri; Rangasamy, Sampathkumar; Shinde, Deepali N; Spiegel, Ronen; Timmerman, Vincent; von Spiczak, Sarah; Helbig, Ingo; Weckhuysen, Sarah; Francklyn, Christopher; Antonellis, Anthony; de Witte, Peter; De Jonghe, Peter. Biallelic VARS variants cause developmental encephalopathy with microcephaly that is recapitulated in vars knockout zebrafish. Nature Communications. 2019;10(1):708.  PubMed