Anti VARS pAb (ATL-HPA046710 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046710-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: VARS
Alternative Gene Name: VARS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007029: 93%, ENSRNOG00000000867: 93%
Entrez Gene ID: 7407
Uniprot ID: P26640
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML |
| Gene Sequence | AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML |
| Gene ID - Mouse | ENSMUSG00000007029 |
| Gene ID - Rat | ENSRNOG00000000867 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti VARS pAb (ATL-HPA046710 w/enhanced validation) | |
| Datasheet | Anti VARS pAb (ATL-HPA046710 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VARS pAb (ATL-HPA046710 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti VARS pAb (ATL-HPA046710 w/enhanced validation) | |
| Datasheet | Anti VARS pAb (ATL-HPA046710 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti VARS pAb (ATL-HPA046710 w/enhanced validation) |
| Citations for Anti VARS pAb (ATL-HPA046710 w/enhanced validation) – 1 Found |
| Siekierska, Aleksandra; Stamberger, Hannah; Deconinck, Tine; Oprescu, Stephanie N; Partoens, Michèle; Zhang, Yifan; Sourbron, Jo; Adriaenssens, Elias; Mullen, Patrick; Wiencek, Patrick; Hardies, Katia; Lee, Jeong-Soo; Giong, Hoi-Khoanh; Distelmaier, Felix; Elpeleg, Orly; Helbig, Katherine L; Hersh, Joseph; Isikay, Sedat; Jordan, Elizabeth; Karaca, Ender; Kecskes, Angela; Lupski, James R; Kovacs-Nagy, Reka; May, Patrick; Narayanan, Vinodh; Pendziwiat, Manuela; Ramsey, Keri; Rangasamy, Sampathkumar; Shinde, Deepali N; Spiegel, Ronen; Timmerman, Vincent; von Spiczak, Sarah; Helbig, Ingo; Weckhuysen, Sarah; Francklyn, Christopher; Antonellis, Anthony; de Witte, Peter; De Jonghe, Peter. Biallelic VARS variants cause developmental encephalopathy with microcephaly that is recapitulated in vars knockout zebrafish. Nature Communications. 2019;10(1):708. PubMed |