Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050418-25

Protein Description: vesicle-associated membrane protein 4
Gene Name: VAMP4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026696: 100%, ENSRNOG00000003071: 100%
Entrez Gene ID: 8674
Uniprot ID: O75379
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK
• Gene Sequence: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK
• Gene ID - Mouse: ENSMUSG00000026696
• Gene ID - Rat: ENSRNOG00000003071
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti VAMP4 pAb (ATL-HPA050418 w/enhanced validation) – 1 Found

Postema, Meagan M; Grega-Larson, Nathan E; Meenderink, Leslie M; Tyska, Matthew J. PACSIN2-dependent apical endocytosis regulates the morphology of epithelial microvilli. Molecular Biology Of The Cell. 2019;30(19):2515-2526.