Anti VAC14 pAb (ATL-HPA075382)

Atlas Antibodies

SKU: ATL-HPA075382-25

• 
• 

Protein Description: Vac14, PIKFYVE complex component
Gene Name: VAC14
Alternative Gene Name: ArPIKfyve, FLJ10305, TAX1BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010936: 95%, ENSRNOG00000017219: 94%
Entrez Gene ID: 55697
Uniprot ID: Q08AM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV
• Gene Sequence: IECPIFTYLRLQLLDVKNNPYLIKALYGLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEV
• Gene ID - Mouse: ENSMUSG00000010936
• Gene ID - Rat: ENSRNOG00000017219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.