Anti UXT pAb (ATL-HPA058400)

Atlas Antibodies

Catalog No.:
ATL-HPA058400-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitously-expressed, prefoldin-like chaperone
Gene Name: UXT
Alternative Gene Name: ART-27, STAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001134: 90%, ENSRNOG00000009893: 88%
Entrez Gene ID: 8409
Uniprot ID: Q9UBK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Gene Sequence LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
Gene ID - Mouse ENSMUSG00000001134
Gene ID - Rat ENSRNOG00000009893
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UXT pAb (ATL-HPA058400)
Datasheet Anti UXT pAb (ATL-HPA058400) Datasheet (External Link)
Vendor Page Anti UXT pAb (ATL-HPA058400) at Atlas Antibodies

Documents & Links for Anti UXT pAb (ATL-HPA058400)
Datasheet Anti UXT pAb (ATL-HPA058400) Datasheet (External Link)
Vendor Page Anti UXT pAb (ATL-HPA058400)