Anti UXT pAb (ATL-HPA058400)

Atlas Antibodies

Catalog No.: ATL-HPA058400-25

Protein Description: ubiquitously-expressed, prefoldin-like chaperone
Gene Name: UXT
Alternative Gene Name: ART-27, STAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001134: 90%, ENSRNOG00000009893: 88%
Entrez Gene ID: 8409
Uniprot ID: Q9UBK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
• Gene Sequence: LKFIDRKSSLLTELSNSLTKDSMNIKAHIHMLLEGLRELQGLQNFPEKPHH
• Gene ID - Mouse: ENSMUSG00000001134
• Gene ID - Rat: ENSRNOG00000009893
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.