Anti UXT pAb (ATL-HPA050499)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050499-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UXT
Alternative Gene Name: ART-27, STAP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001134: 81%, ENSRNOG00000009893: 80%
Entrez Gene ID: 8409
Uniprot ID: Q9UBK9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSE |
Gene Sequence | QEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLQLRNVIERLQEAKHSE |
Gene ID - Mouse | ENSMUSG00000001134 |
Gene ID - Rat | ENSRNOG00000009893 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UXT pAb (ATL-HPA050499) | |
Datasheet | Anti UXT pAb (ATL-HPA050499) Datasheet (External Link) |
Vendor Page | Anti UXT pAb (ATL-HPA050499) at Atlas Antibodies |
Documents & Links for Anti UXT pAb (ATL-HPA050499) | |
Datasheet | Anti UXT pAb (ATL-HPA050499) Datasheet (External Link) |
Vendor Page | Anti UXT pAb (ATL-HPA050499) |