Anti UTS2B pAb (ATL-HPA026992)

Atlas Antibodies

Catalog No.:
ATL-HPA026992-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: urotensin 2B
Gene Name: UTS2B
Alternative Gene Name: U2B, URP, UTS2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056423: 48%, ENSRNOG00000038512: 55%
Entrez Gene ID: 257313
Uniprot ID: Q765I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Gene Sequence RPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Gene ID - Mouse ENSMUSG00000056423
Gene ID - Rat ENSRNOG00000038512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UTS2B pAb (ATL-HPA026992)
Datasheet Anti UTS2B pAb (ATL-HPA026992) Datasheet (External Link)
Vendor Page Anti UTS2B pAb (ATL-HPA026992) at Atlas Antibodies

Documents & Links for Anti UTS2B pAb (ATL-HPA026992)
Datasheet Anti UTS2B pAb (ATL-HPA026992) Datasheet (External Link)
Vendor Page Anti UTS2B pAb (ATL-HPA026992)