Anti UTS2B pAb (ATL-HPA026992)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026992-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: UTS2B
Alternative Gene Name: U2B, URP, UTS2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056423: 48%, ENSRNOG00000038512: 55%
Entrez Gene ID: 257313
Uniprot ID: Q765I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV |
| Gene Sequence | RPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV |
| Gene ID - Mouse | ENSMUSG00000056423 |
| Gene ID - Rat | ENSRNOG00000038512 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTS2B pAb (ATL-HPA026992) | |
| Datasheet | Anti UTS2B pAb (ATL-HPA026992) Datasheet (External Link) |
| Vendor Page | Anti UTS2B pAb (ATL-HPA026992) at Atlas Antibodies |
| Documents & Links for Anti UTS2B pAb (ATL-HPA026992) | |
| Datasheet | Anti UTS2B pAb (ATL-HPA026992) Datasheet (External Link) |
| Vendor Page | Anti UTS2B pAb (ATL-HPA026992) |