Anti UTS2 pAb (ATL-HPA017000)

Atlas Antibodies

Catalog No.:
ATL-HPA017000-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: urotensin 2
Gene Name: UTS2
Alternative Gene Name: PRO1068, U-II, UCN2, UII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028963: 37%, ENSRNOG00000018393: 34%
Entrez Gene ID: 10911
Uniprot ID: O95399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Gene Sequence TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Gene ID - Mouse ENSMUSG00000028963
Gene ID - Rat ENSRNOG00000018393
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UTS2 pAb (ATL-HPA017000)
Datasheet Anti UTS2 pAb (ATL-HPA017000) Datasheet (External Link)
Vendor Page Anti UTS2 pAb (ATL-HPA017000) at Atlas Antibodies

Documents & Links for Anti UTS2 pAb (ATL-HPA017000)
Datasheet Anti UTS2 pAb (ATL-HPA017000) Datasheet (External Link)
Vendor Page Anti UTS2 pAb (ATL-HPA017000)