Anti UTS2 pAb (ATL-HPA017000)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017000-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UTS2
Alternative Gene Name: PRO1068, U-II, UCN2, UII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028963: 37%, ENSRNOG00000018393: 34%
Entrez Gene ID: 10911
Uniprot ID: O95399
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV |
| Gene Sequence | TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLIHDLLLEISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV |
| Gene ID - Mouse | ENSMUSG00000028963 |
| Gene ID - Rat | ENSRNOG00000018393 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTS2 pAb (ATL-HPA017000) | |
| Datasheet | Anti UTS2 pAb (ATL-HPA017000) Datasheet (External Link) |
| Vendor Page | Anti UTS2 pAb (ATL-HPA017000) at Atlas Antibodies |
| Documents & Links for Anti UTS2 pAb (ATL-HPA017000) | |
| Datasheet | Anti UTS2 pAb (ATL-HPA017000) Datasheet (External Link) |
| Vendor Page | Anti UTS2 pAb (ATL-HPA017000) |