Anti UTP6 pAb (ATL-HPA055806)

Atlas Antibodies

Catalog No.:
ATL-HPA055806-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: UTP6, small subunit (SSU) processome component, homolog (yeast)
Gene Name: UTP6
Alternative Gene Name: C17orf40, HCA66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035575: 87%, ENSRNOG00000014209: 84%
Entrez Gene ID: 55813
Uniprot ID: Q9NYH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYKKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDYMKEELNHPLGRPENCGQIYWRAMKMLQG
Gene Sequence AKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYKKARAVFKSLQESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMDYMKEELNHPLGRPENCGQIYWRAMKMLQG
Gene ID - Mouse ENSMUSG00000035575
Gene ID - Rat ENSRNOG00000014209
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UTP6 pAb (ATL-HPA055806)
Datasheet Anti UTP6 pAb (ATL-HPA055806) Datasheet (External Link)
Vendor Page Anti UTP6 pAb (ATL-HPA055806) at Atlas Antibodies

Documents & Links for Anti UTP6 pAb (ATL-HPA055806)
Datasheet Anti UTP6 pAb (ATL-HPA055806) Datasheet (External Link)
Vendor Page Anti UTP6 pAb (ATL-HPA055806)