Anti UTP23 pAb (ATL-HPA044418)

Atlas Antibodies

Catalog No.: ATL-HPA044418-25

Protein Description: UTP23, small subunit (SSU) processome component, homolog (yeast)
Gene Name: UTP23
Alternative Gene Name: C8orf53, MGC14595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022313: 88%, ENSRNOG00000004387: 89%
Entrez Gene ID: 84294
Uniprot ID: Q9BRU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQL
• Gene Sequence: KCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQL
• Gene ID - Mouse: ENSMUSG00000022313
• Gene ID - Rat: ENSRNOG00000004387
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.