Anti UTP18 pAb (ATL-HPA052378)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052378-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: UTP18
Alternative Gene Name: CGI-48, WDR50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054079: 76%, ENSRNOG00000002644: 81%
Entrez Gene ID: 51096
Uniprot ID: Q9Y5J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT |
| Gene Sequence | HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT |
| Gene ID - Mouse | ENSMUSG00000054079 |
| Gene ID - Rat | ENSRNOG00000002644 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTP18 pAb (ATL-HPA052378) | |
| Datasheet | Anti UTP18 pAb (ATL-HPA052378) Datasheet (External Link) |
| Vendor Page | Anti UTP18 pAb (ATL-HPA052378) at Atlas Antibodies |
| Documents & Links for Anti UTP18 pAb (ATL-HPA052378) | |
| Datasheet | Anti UTP18 pAb (ATL-HPA052378) Datasheet (External Link) |
| Vendor Page | Anti UTP18 pAb (ATL-HPA052378) |