Anti UTP18 pAb (ATL-HPA052378)

Atlas Antibodies

SKU: ATL-HPA052378-100

• 
• 
• 

Protein Description: UTP18 small subunit (SSU) processome component homolog (yeast)
Gene Name: UTP18
Alternative Gene Name: CGI-48, WDR50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054079: 76%, ENSRNOG00000002644: 81%
Entrez Gene ID: 51096
Uniprot ID: Q9Y5J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT
• Gene Sequence: HEDSGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKKRLKEEFQHAMGGVPAWAETTKRKT
• Gene ID - Mouse: ENSMUSG00000054079
• Gene ID - Rat: ENSRNOG00000002644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.