Anti UTP14C pAb (ATL-HPA054023)

Atlas Antibodies

SKU: ATL-HPA054023-25

• 

Protein Description: UTP14, U3 small nucleolar ribonucleoprotein, homolog C (yeast)
Gene Name: UTP14C
Alternative Gene Name: 2700066J21Rik, KIAA0266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063785: 59%, ENSRNOG00000005012: 57%
Entrez Gene ID: 9724
Uniprot ID: Q5TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ
• Gene Sequence: RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ
• Gene ID - Mouse: ENSMUSG00000063785
• Gene ID - Rat: ENSRNOG00000005012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.