Anti UTP14C pAb (ATL-HPA054023)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054023-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: UTP14C
Alternative Gene Name: 2700066J21Rik, KIAA0266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063785: 59%, ENSRNOG00000005012: 57%
Entrez Gene ID: 9724
Uniprot ID: Q5TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ |
| Gene Sequence | RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ |
| Gene ID - Mouse | ENSMUSG00000063785 |
| Gene ID - Rat | ENSRNOG00000005012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti UTP14C pAb (ATL-HPA054023) | |
| Datasheet | Anti UTP14C pAb (ATL-HPA054023) Datasheet (External Link) |
| Vendor Page | Anti UTP14C pAb (ATL-HPA054023) at Atlas Antibodies |
| Documents & Links for Anti UTP14C pAb (ATL-HPA054023) | |
| Datasheet | Anti UTP14C pAb (ATL-HPA054023) Datasheet (External Link) |
| Vendor Page | Anti UTP14C pAb (ATL-HPA054023) |