Anti UTP14C pAb (ATL-HPA054023)
Atlas Antibodies
- SKU:
- ATL-HPA054023-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: UTP14C
Alternative Gene Name: 2700066J21Rik, KIAA0266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063785: 59%, ENSRNOG00000005012: 57%
Entrez Gene ID: 9724
Uniprot ID: Q5TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ |
Gene Sequence | RVQTLEELEELGKEDCFQNKELPRPVLEGQQSERTPNNRPDAPKEKKEKEQ |
Gene ID - Mouse | ENSMUSG00000063785 |
Gene ID - Rat | ENSRNOG00000005012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UTP14C pAb (ATL-HPA054023) | |
Datasheet | Anti UTP14C pAb (ATL-HPA054023) Datasheet (External Link) |
Vendor Page | Anti UTP14C pAb (ATL-HPA054023) at Atlas Antibodies |
Documents & Links for Anti UTP14C pAb (ATL-HPA054023) | |
Datasheet | Anti UTP14C pAb (ATL-HPA054023) Datasheet (External Link) |
Vendor Page | Anti UTP14C pAb (ATL-HPA054023) |