Anti UTP14C pAb (ATL-HPA047217)

Atlas Antibodies

Catalog No.:
ATL-HPA047217-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: UTP14, U3 small nucleolar ribonucleoprotein, homolog C (yeast)
Gene Name: UTP14C
Alternative Gene Name: 2700066J21Rik, KIAA0266
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063785: 98%, ENSRNOG00000005012: 97%
Entrez Gene ID: 9724
Uniprot ID: Q5TAP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEE
Gene Sequence ARMMERMSLKHQNSGKWAKSKAIMAKYDLEARQAMQEQLAKNKELTQKLQVASESEEE
Gene ID - Mouse ENSMUSG00000063785
Gene ID - Rat ENSRNOG00000005012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti UTP14C pAb (ATL-HPA047217)
Datasheet Anti UTP14C pAb (ATL-HPA047217) Datasheet (External Link)
Vendor Page Anti UTP14C pAb (ATL-HPA047217) at Atlas Antibodies

Documents & Links for Anti UTP14C pAb (ATL-HPA047217)
Datasheet Anti UTP14C pAb (ATL-HPA047217) Datasheet (External Link)
Vendor Page Anti UTP14C pAb (ATL-HPA047217)