Anti UTP11 pAb (ATL-HPA045830)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045830-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: UTP11
Alternative Gene Name: CGI-94, UTP11L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028907: 93%, ENSRNOG00000007174: 93%
Entrez Gene ID: 51118
Uniprot ID: Q9Y3A2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL |
Gene Sequence | HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL |
Gene ID - Mouse | ENSMUSG00000028907 |
Gene ID - Rat | ENSRNOG00000007174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti UTP11 pAb (ATL-HPA045830) | |
Datasheet | Anti UTP11 pAb (ATL-HPA045830) Datasheet (External Link) |
Vendor Page | Anti UTP11 pAb (ATL-HPA045830) at Atlas Antibodies |
Documents & Links for Anti UTP11 pAb (ATL-HPA045830) | |
Datasheet | Anti UTP11 pAb (ATL-HPA045830) Datasheet (External Link) |
Vendor Page | Anti UTP11 pAb (ATL-HPA045830) |