Anti USP8 pAb (ATL-HPA050215)

Atlas Antibodies

Catalog No.: ATL-HPA050215-25

Protein Description: ubiquitin specific peptidase 8
Gene Name: USP8
Alternative Gene Name: HumORF8, KIAA0055, SPG59, UBPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027363: 78%, ENSRNOG00000010729: 76%
Entrez Gene ID: 9101
Uniprot ID: P40818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
• Gene Sequence: KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
• Gene ID - Mouse: ENSMUSG00000027363
• Gene ID - Rat: ENSRNOG00000010729
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.