Anti USP8 pAb (ATL-HPA050215)

Atlas Antibodies

Catalog No.:
ATL-HPA050215-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 8
Gene Name: USP8
Alternative Gene Name: HumORF8, KIAA0055, SPG59, UBPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027363: 78%, ENSRNOG00000010729: 76%
Entrez Gene ID: 9101
Uniprot ID: P40818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
Gene Sequence KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD
Gene ID - Mouse ENSMUSG00000027363
Gene ID - Rat ENSRNOG00000010729
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP8 pAb (ATL-HPA050215)
Datasheet Anti USP8 pAb (ATL-HPA050215) Datasheet (External Link)
Vendor Page Anti USP8 pAb (ATL-HPA050215) at Atlas Antibodies

Documents & Links for Anti USP8 pAb (ATL-HPA050215)
Datasheet Anti USP8 pAb (ATL-HPA050215) Datasheet (External Link)
Vendor Page Anti USP8 pAb (ATL-HPA050215)