Anti USP8 pAb (ATL-HPA050215)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050215-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: USP8
Alternative Gene Name: HumORF8, KIAA0055, SPG59, UBPY
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027363: 78%, ENSRNOG00000010729: 76%
Entrez Gene ID: 9101
Uniprot ID: P40818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD |
| Gene Sequence | KRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTD |
| Gene ID - Mouse | ENSMUSG00000027363 |
| Gene ID - Rat | ENSRNOG00000010729 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP8 pAb (ATL-HPA050215) | |
| Datasheet | Anti USP8 pAb (ATL-HPA050215) Datasheet (External Link) |
| Vendor Page | Anti USP8 pAb (ATL-HPA050215) at Atlas Antibodies |
| Documents & Links for Anti USP8 pAb (ATL-HPA050215) | |
| Datasheet | Anti USP8 pAb (ATL-HPA050215) Datasheet (External Link) |
| Vendor Page | Anti USP8 pAb (ATL-HPA050215) |