Anti USP54 pAb (ATL-HPA063665)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063665-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE |
| Gene Sequence | EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE |
| Gene ID - Mouse | ENSMUSG00000034235 |
| Gene ID - Rat | ENSRNOG00000027012 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
| Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
| Vendor Page | Anti USP54 pAb (ATL-HPA063665) at Atlas Antibodies |
| Documents & Links for Anti USP54 pAb (ATL-HPA063665) | |
| Datasheet | Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link) |
| Vendor Page | Anti USP54 pAb (ATL-HPA063665) |