Anti USP54 pAb (ATL-HPA063665)

Atlas Antibodies

Catalog No.:
ATL-HPA063665-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 54
Gene Name: USP54
Alternative Gene Name: bA137L10.3, bA137L10.4, C10orf29, FLJ37318
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034235: 95%, ENSRNOG00000027012: 91%
Entrez Gene ID: 159195
Uniprot ID: Q70EL1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE
Gene Sequence EPSISSDTRTDSSTESYPYKHSHHESVVSHFSSDSQGTVIYNVENDSMSQSSRDTGHLTDSECNQKHTSKKGSLIERKRSSGRVRRKGDEPQASGYHSEGE
Gene ID - Mouse ENSMUSG00000034235
Gene ID - Rat ENSRNOG00000027012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP54 pAb (ATL-HPA063665)
Datasheet Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link)
Vendor Page Anti USP54 pAb (ATL-HPA063665) at Atlas Antibodies

Documents & Links for Anti USP54 pAb (ATL-HPA063665)
Datasheet Anti USP54 pAb (ATL-HPA063665) Datasheet (External Link)
Vendor Page Anti USP54 pAb (ATL-HPA063665)