Anti USP49 pAb (ATL-HPA030254)

Atlas Antibodies

Catalog No.: ATL-HPA030254-25

Protein Description: ubiquitin specific peptidase 49
Gene Name: USP49
Alternative Gene Name: MGC20741
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090115: 86%, ENSRNOG00000013866: 88%
Entrez Gene ID: 25862
Uniprot ID: Q70CQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQKQDTPVRRGRTLRSMASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALERK
• Gene Sequence: GQKQDTPVRRGRTLRSMASGEDVVLPQRAPQGQPQMLTALWYRRQRLLARTLRLWFEKSSRGQAKLEQRRQEEALERK
• Gene ID - Mouse: ENSMUSG00000090115
• Gene ID - Rat: ENSRNOG00000013866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.