Anti USP47 pAb (ATL-HPA029286)

Atlas Antibodies

Catalog No.:
ATL-HPA029286-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 47
Gene Name: USP47
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059263: 97%, ENSRNOG00000026754: 97%
Entrez Gene ID: 55031
Uniprot ID: Q96K76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSY
Gene Sequence PTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETRKPDQVFQSY
Gene ID - Mouse ENSMUSG00000059263
Gene ID - Rat ENSRNOG00000026754
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP47 pAb (ATL-HPA029286)
Datasheet Anti USP47 pAb (ATL-HPA029286) Datasheet (External Link)
Vendor Page Anti USP47 pAb (ATL-HPA029286) at Atlas Antibodies

Documents & Links for Anti USP47 pAb (ATL-HPA029286)
Datasheet Anti USP47 pAb (ATL-HPA029286) Datasheet (External Link)
Vendor Page Anti USP47 pAb (ATL-HPA029286)