Anti USP45 pAb (ATL-HPA029604)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029604-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: USP45
Alternative Gene Name: MGC14793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040455: 80%, ENSRNOG00000008688: 81%
Entrez Gene ID: 85015
Uniprot ID: Q70EL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQ |
| Gene Sequence | EKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQ |
| Gene ID - Mouse | ENSMUSG00000040455 |
| Gene ID - Rat | ENSRNOG00000008688 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti USP45 pAb (ATL-HPA029604) | |
| Datasheet | Anti USP45 pAb (ATL-HPA029604) Datasheet (External Link) |
| Vendor Page | Anti USP45 pAb (ATL-HPA029604) at Atlas Antibodies |
| Documents & Links for Anti USP45 pAb (ATL-HPA029604) | |
| Datasheet | Anti USP45 pAb (ATL-HPA029604) Datasheet (External Link) |
| Vendor Page | Anti USP45 pAb (ATL-HPA029604) |