Anti USP45 pAb (ATL-HPA029602)

Atlas Antibodies

Catalog No.:
ATL-HPA029602-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 45
Gene Name: USP45
Alternative Gene Name: MGC14793
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040455: 70%, ENSRNOG00000008688: 72%
Entrez Gene ID: 85015
Uniprot ID: Q70EL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIENIHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVT
Gene Sequence EECANISTVKDPFIDISLPIIEERVSKPLLWGRMNKYRSLRETDHDRYSGNVTIENIHQPRAAKKHSSSKDKSQLIHDRKCIRKLSSGETVT
Gene ID - Mouse ENSMUSG00000040455
Gene ID - Rat ENSRNOG00000008688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP45 pAb (ATL-HPA029602)
Datasheet Anti USP45 pAb (ATL-HPA029602) Datasheet (External Link)
Vendor Page Anti USP45 pAb (ATL-HPA029602) at Atlas Antibodies

Documents & Links for Anti USP45 pAb (ATL-HPA029602)
Datasheet Anti USP45 pAb (ATL-HPA029602) Datasheet (External Link)
Vendor Page Anti USP45 pAb (ATL-HPA029602)