Anti USP42 pAb (ATL-HPA064800)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064800-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 83%, ENSRNOG00000001059: 85%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL |
Gene Sequence | TIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGAVVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVL |
Gene ID - Mouse | ENSMUSG00000051306 |
Gene ID - Rat | ENSRNOG00000001059 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti USP42 pAb (ATL-HPA064800) | |
Datasheet | Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link) |
Vendor Page | Anti USP42 pAb (ATL-HPA064800) at Atlas Antibodies |
Documents & Links for Anti USP42 pAb (ATL-HPA064800) | |
Datasheet | Anti USP42 pAb (ATL-HPA064800) Datasheet (External Link) |
Vendor Page | Anti USP42 pAb (ATL-HPA064800) |