Anti USP42 pAb (ATL-HPA006752)

Atlas Antibodies

Catalog No.: ATL-HPA006752-25

Protein Description: ubiquitin specific peptidase 42
Gene Name: USP42
Alternative Gene Name: FLJ12697
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051306: 71%, ENSRNOG00000001059: 75%
Entrez Gene ID: 84132
Uniprot ID: Q9H9J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTK
• Gene Sequence: PQLPSHMIKNPPHLNGTGPLKDTPSSSMSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPNLHSNSLENPTKPVPSSTITNSAVQSTSNASTMSVSSKVTK
• Gene ID - Mouse: ENSMUSG00000051306
• Gene ID - Rat: ENSRNOG00000001059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP42 pAb (ATL-HPA006752) – 4 Found

Spolverini, A; Fuchs, G; Bublik, D R; Oren, M. let-7b and let-7c microRNAs promote histone H2B ubiquitylation and inhibit cell migration by targeting multiple components of the H2B deubiquitylation machinery. Oncogene. 2017;36(42):5819-5828. 

Hock, Andreas K; Vigneron, Arnaud M; Carter, Stephanie; Ludwig, Robert L; Vousden, Karen H. Regulation of p53 stability and function by the deubiquitinating enzyme USP42. The Embo Journal. 2011;30(24):4921-30. 

Hock, Andreas K; Vigneron, Arnaud M; Vousden, Karen H. Ubiquitin-specific peptidase 42 (USP42) functions to deubiquitylate histones and regulate transcriptional activity. The Journal Of Biological Chemistry. 2014;289(50):34862-70. 

Elu, Nagore; Osinalde, Nerea; Beaskoetxea, Javier; Ramirez, Juanma; Lectez, Benoit; Aloria, Kerman; Rodriguez, Jose Antonio; Arizmendi, Jesus M; Mayor, Ugo. Detailed Dissection of UBE3A-Mediated DDI1 Ubiquitination. Frontiers In Physiology. 10( 31130875):534.