Anti USP39 pAb (ATL-HPA077350)

Atlas Antibodies

Catalog No.:
ATL-HPA077350-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 39
Gene Name: USP39
Alternative Gene Name: CGI-21, SAD1, SNRNP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056305: 100%, ENSRNOG00000010930: 100%
Entrez Gene ID: 10713
Uniprot ID: Q53GS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
Gene Sequence TIVNFPITNVDLREYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDETN
Gene ID - Mouse ENSMUSG00000056305
Gene ID - Rat ENSRNOG00000010930
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP39 pAb (ATL-HPA077350)
Datasheet Anti USP39 pAb (ATL-HPA077350) Datasheet (External Link)
Vendor Page Anti USP39 pAb (ATL-HPA077350) at Atlas Antibodies

Documents & Links for Anti USP39 pAb (ATL-HPA077350)
Datasheet Anti USP39 pAb (ATL-HPA077350) Datasheet (External Link)
Vendor Page Anti USP39 pAb (ATL-HPA077350)