Anti USP34 pAb (ATL-HPA025815)

Atlas Antibodies

Catalog No.:
ATL-HPA025815-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ubiquitin specific peptidase 34
Gene Name: USP34
Alternative Gene Name: KIAA0570, KIAA0729
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056342: 100%, ENSRNOG00000058664: 21%
Entrez Gene ID: 9736
Uniprot ID: Q70CQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLI
Gene Sequence QHIIPFRTYVIRYLCKLSDQELRQSAARNMADLMWSTVKEPLDTTLCFDKESLDLAFKYFMSPTLTMRLAGLSQITNQLHTFNDVCNNESLVSDTETSIAKELADWLI
Gene ID - Mouse ENSMUSG00000056342
Gene ID - Rat ENSRNOG00000058664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti USP34 pAb (ATL-HPA025815)
Datasheet Anti USP34 pAb (ATL-HPA025815) Datasheet (External Link)
Vendor Page Anti USP34 pAb (ATL-HPA025815) at Atlas Antibodies

Documents & Links for Anti USP34 pAb (ATL-HPA025815)
Datasheet Anti USP34 pAb (ATL-HPA025815) Datasheet (External Link)
Vendor Page Anti USP34 pAb (ATL-HPA025815)