Anti USP33 pAb (ATL-HPA005719)

Atlas Antibodies

Catalog No.: ATL-HPA005719-25

Protein Description: ubiquitin specific peptidase 33
Gene Name: USP33
Alternative Gene Name: KIAA1097, VDU1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025437: 91%, ENSRNOG00000011294: 91%
Entrez Gene ID: 23032
Uniprot ID: Q8TEY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS
• Gene Sequence: ESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALS
• Gene ID - Mouse: ENSMUSG00000025437
• Gene ID - Rat: ENSRNOG00000011294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti USP33 pAb (ATL-HPA005719) – 1 Found

Guo, Fei; Zhang, Chao; Wang, Fubo; Zhang, Wei; Shi, Xiaolei; Zhu, Yasheng; Fang, Ziyu; Yang, Bo; Sun, Yinghao. Deubiquitinating enzyme USP33 restrains docetaxel-induced apoptosis via stabilising the phosphatase DUSP1 in prostate cancer. Cell Death And Differentiation. 2020;27(6):1938-1951.